PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P01960_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 192aa    MW: 22462.4 Da    PI: 6.8957
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P01960_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.2e-101181532055
                            HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  GSMUA_Achr5P01960_001 118 YKWPYPSESEKLALAESTGLDQKQINNWFINQRKRH 153
                            4679*****************************885 PP

2ELK38.91.8e-137394122
                    ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                           ELKh+Ll+KYsgyL+sL+qE+s
  GSMUA_Achr5P01960_001 73 ELKHHLLKKYSGYLSSLRQELS 94
                           9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037912.1E-8229IPR005541KNOX2
PROSITE profilePS5121311.5237393IPR005539ELK domain
PfamPF037891.6E-107394IPR005539ELK domain
SMARTSM011882.8E-77394IPR005539ELK domain
PROSITE profilePS5007113.5493156IPR001356Homeobox domain
SuperFamilySSF466892.05E-2094169IPR009057Homeodomain-like
SMARTSM003891.6E-1395160IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-2798159IPR009057Homeodomain-like
CDDcd000861.16E-12105157No hitNo description
PfamPF059207.0E-17113152IPR008422Homeobox KN domain
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MRYRVELTRP FQEAMDFLKT VESQFNALTN TSSLRLFSSD ERCEDVASSE EDPDASGGEA  60
DILEIDPRAE DKELKHHLLK KYSGYLSSLR QELSKKRKKG KLPKEARQKL LKWWELHYKW  120
PYPSESEKLA LAESTGLDQK QINNWFINQR KRHWRPSEDM QLMVMDGFHP QNAAALYMEG  180
HFMGDGLYHV GP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18897LRQELSKKRK
29498KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399080.11e-141PREDICTED: homeobox protein rough sheath 1-like
SwissprotQ413301e-98KN1_SOLLC; Homeotic protein knotted-1
TrEMBLM0SUX51e-143M0SUX5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P01960_0011e-142(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.14e-75KNOTTED-like from Arabidopsis thaliana